PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00081038001
Common NameGSBRNA2T00081038001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family CO-like
Protein Properties Length: 402aa    MW: 45395 Da    PI: 5.1982
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00081038001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box261.9e-081458341
             zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvp 41
                         +r C+ + + +++++C  ++ +lC++C  + H+       H++v 
  GSBRNA2T00081038001 14 ARACDSCLKRRARWYCAADDAFLCHSCDGSVHSAnplarrHERVL 58
                         578*****************************6678888898875 PP

2CCT68.51.8e-23352395144
                  CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                          Rea+++RY+eKr+tR+F+KkirYe+RK +Ae+RpR+KGrFvk++
  GSBRNA2T00081038001 352 REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRS 395
                          9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003365.4E-121259IPR000315B-box-type zinc finger
PROSITE profilePS5011910.5091259IPR000315B-box-type zinc finger
PfamPF006439.3E-71458IPR000315B-box-type zinc finger
CDDcd000218.15E-91559No hitNo description
PROSITE profilePS5101716.083352394IPR010402CCT domain
PfamPF062035.2E-18352394IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 402 aa     Download sequence    Send to blast
MMKNLANVVG GKTARACDSC LKRRARWYCA ADDAFLCHSC DGSVHSANPL ARRHERVLLK  60
SASPGKQRHD SSSPPHPPTW HQGFTRKART PRGGKKSHTM IFHDLVPEMS SEDQSFEVEE  120
QLIFEVPVLN PMSHEKCLNE SVETKIELPL MSMCFKGSDE EDDNAESCLN GLFPTDTELA  180
QFSADVEILL GGGTDREYNM EELGLGEMLK VEKEEVDEEE EVATIDVCDL DAADEITPFV  240
ISFENEYSQK TNLEEEDEKQ DVENNILDVG VNEMSCSIKE EKNEKVHMLR LDYESVISTW  300
GGQGTPWTAR ETPQIDLNML CCPTDSMVES GGEAHHHNYV RGLGLHMGEA GREARVSRYR  360
EKRRTRLFSK KIRYEVRKLN AEKRPRMKGR FVKRSSIAAA H*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1362378RRTRLFSKKIRYEVRKL
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00081038001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013612871.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 6-like
SwissprotQ8LG760.0COL6_ARATH; Zinc finger protein CONSTANS-LIKE 6
TrEMBLA0A078I1Z80.0A0A078I1Z8_BRANA; BnaA02g13920D protein
STRINGBra033925.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM24672767
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68520.10.0B-box type zinc finger protein with CCT domain
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]